Review



concentration 10× tirap  (Novus Biologicals)


Bioz Verified Symbol Novus Biologicals is a verified supplier
Bioz Manufacturer Symbol Novus Biologicals manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 91
      Buy from Supplier

    Structured Review

    Novus Biologicals concentration 10× tirap
    Concentration 10× Tirap, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 91/100, based on 9 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/concentration+10%C3%97+tirap/TIRAP+(TLR2+and+TLR4)+Inhibitor+Peptide+Set/pmc08509240-57-19-29
    Average 91 stars, based on 9 article reviews
    concentration 10× tirap - by Bioz Stars, 2026-09
    91/100 stars

    Images

    Related Articles

    Sterility:

    Article Title: Attenuative Effects of Platelet-Rich Plasma on 30 kDa Fibronectin Fragment-Induced MMP-13 Expression Associated with TLR2 Signaling in Osteoarthritic Chondrocytes and Synovial Fibroblasts
    Article Snippet: .. The cells were washed with sterile PBS twice, placed in serum-free media for 2 h, co-incubated with 10 times concentration (10×) TIRAP (TLR2 and TLR4) inhibitor peptide set (NBP2-26245, Novus Biologicals, Littleton, CO, USA) and PRP for 2 h, and then co-incubated with 30 kDa fibronectin proteolytic fragments at a concentration of 0.25 mg/mL for 4 h. The set contained TIRAP inhibitor peptide (1 mg of DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS) and control peptide (1 mg of DRQIKIWFQNRRMKWKK), two peptides for research. ..

    Concentration Assay:

    Article Title: Attenuative Effects of Platelet-Rich Plasma on 30 kDa Fibronectin Fragment-Induced MMP-13 Expression Associated with TLR2 Signaling in Osteoarthritic Chondrocytes and Synovial Fibroblasts
    Article Snippet: .. The cells were washed with sterile PBS twice, placed in serum-free media for 2 h, co-incubated with 10 times concentration (10×) TIRAP (TLR2 and TLR4) inhibitor peptide set (NBP2-26245, Novus Biologicals, Littleton, CO, USA) and PRP for 2 h, and then co-incubated with 30 kDa fibronectin proteolytic fragments at a concentration of 0.25 mg/mL for 4 h. The set contained TIRAP inhibitor peptide (1 mg of DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS) and control peptide (1 mg of DRQIKIWFQNRRMKWKK), two peptides for research. ..

    Control:

    Article Title: Attenuative Effects of Platelet-Rich Plasma on 30 kDa Fibronectin Fragment-Induced MMP-13 Expression Associated with TLR2 Signaling in Osteoarthritic Chondrocytes and Synovial Fibroblasts
    Article Snippet: .. The cells were washed with sterile PBS twice, placed in serum-free media for 2 h, co-incubated with 10 times concentration (10×) TIRAP (TLR2 and TLR4) inhibitor peptide set (NBP2-26245, Novus Biologicals, Littleton, CO, USA) and PRP for 2 h, and then co-incubated with 30 kDa fibronectin proteolytic fragments at a concentration of 0.25 mg/mL for 4 h. The set contained TIRAP inhibitor peptide (1 mg of DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS) and control peptide (1 mg of DRQIKIWFQNRRMKWKK), two peptides for research. ..



    Similar Products

    tirap (tlr2 and tlr4) inhibitor peptide set  (Bio-Techne corporation)
    91
    Bio-Techne corporation tirap (tlr2 and tlr4) inhibitor peptide set
    Tirap (Tlr2 And Tlr4) Inhibitor Peptide Set, supplied by Bio-Techne corporation, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/concentration+10%C3%97+tirap/TIRAP+(TLR2+and+TLR4)+Inhibitor+Peptide+Set/bio-techne+corporation___nbp2-26245
    Average 91 stars, based on 1 article reviews
    tirap (tlr2 and tlr4) inhibitor peptide set - by Bioz Stars, 2026-09
    91/100 stars
    		  Buy from Supplier
    concentration 10× tirap  (Novus Biologicals)
    91
    Novus Biologicals concentration 10× tirap
    Concentration 10× Tirap, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/concentration+10%C3%97+tirap/TIRAP+(TLR2+and+TLR4)+Inhibitor+Peptide+Set/pmc08509240-57-19-29
    Average 91 stars, based on 1 article reviews
    concentration 10× tirap - by Bioz Stars, 2026-09
    91/100 stars
    		  Buy from Supplier

    Image Search Results